AibGenesis™ Mouse Anti-rpp14 Antibody (CBMOAB-96484FYA)


Cat: CBMOAB-96484FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-96484FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO96484FYA 100 µg
MO-AB-19535R Monoclonal Cattle (Bos taurus) WB, ELISA MO19535R 100 µg
MO-AB-28639H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28639C 100 µg
MO-AB-63548W Monoclonal Marmoset WB, ELISA MO63548W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO96484FYA
SpecificityThis antibody binds to Zebrafish rpp14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of ribonuclease P and has 3' to 5' exoribonuclease activity. Transcripts for this gene are bicistronic and include a conserved downstream open reading frame for the hydroxyacyl-thioester dehydratase type 2 (HTD2) gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish rpp14 Antibody is a mouse antibody against rpp14. It can be used for rpp14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease P 14 subunit; Rpp14 protein; rpp14; NP_001018528.
UniProt IDQ502A2
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MEDSSKFERYVYKNASVYHYMKISLVLEKENRNISDAQFKQLIISGVKDLYGEIGASFPFDLLKFDPKELTGILRVYNSGLVKLWSALTLLGSYQNEACAFRVTQVSPFLLALSGNSRELQFGDR.
For Research Use Only | Not For Clinical Use.
Online Inquiry