AibGenesis™ Mouse Anti-RPS24 Antibody (CBMOAB-09372HCB)
Cat: CBMOAB-09372HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09372HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO09372HB | 100 µg | ||
| CBMOAB-30116FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO30116FYA | 100 µg | ||
| CBMOAB-56829FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56829FYA | 100 µg | ||
| CBMOAB-60860FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60860FYC | 100 µg | ||
| CBMOAB-96529FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96529FYA | 100 µg | ||
| MO-AB-01520R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01520R | 100 µg | ||
| MO-AB-06851Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06851Y | 100 µg | ||
| MO-AB-09473W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09473W | 100 µg | ||
| MO-AB-09767Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09767Y | 100 µg | ||
| MO-AB-19562R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19562R | 100 µg | ||
| MO-AB-20744W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20744W | 100 µg | ||
| MO-AB-28666H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28666C | 100 µg | ||
| MO-AB-28868R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28868R | 100 µg | ||
| MO-AB-33163W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33163W | 100 µg | ||
| MO-AB-33735H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33735C | 100 µg | ||
| MO-AB-42487W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42487W | 100 µg | ||
| MO-AB-46380W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46380W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO09372HB |
| Specificity | This antibody binds to C. elegans RPS24. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S24E family of ribosomal proteins. It is located in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-C. elegans RPS24 Antibody is a mouse antibody against RPS24. It can be used for RPS24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein RPS-24; rps-24 |
| UniProt ID | Q1XFY9 |
| Protein Refseq | The length of the protein is 131 amino acids long. The sequence is show below: MGDVVTIRTRKVLTNKLLYRKQMVVEVIHPGRPTVPKADIREKIAKLYKTTPDTVIPFGFESKIGGGKSKGFALVYDTIDFAKKFEPKYRLVRMGLATKVEKPGRKQRKERKNRQKKVRGTAKAKVSAGKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry