AibGenesis™ Mouse Anti-RPS27L Antibody (MO-AB-09769Y)
Cat: MO-AB-09769Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-09769Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO09769Y | 100 µg | ||
| CBMOAB-61327FYC | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO61327FYC | 100 µg | ||
| MO-AB-08862W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08862W | 100 µg | ||
| MO-AB-21606W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21606W | 100 µg | ||
| MO-AB-35604W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35604W | 100 µg | ||
| MO-AB-38736W | Monoclonal | Gorilla | WB, ELISA | MO38736W | 100 µg | ||
| MO-AB-42490W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42490W | 100 µg | ||
| MO-AB-46383W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46383W | 100 µg | ||
| MO-AB-63573W | Monoclonal | Marmoset | WB, ELISA | MO63573W | 100 µg | ||
| MO-AB-19568R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19568R | 100 µg | ||
| MO-AB-28869R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28869R | 100 µg | ||
| MO-AB-23690H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23690C | 100 µg | ||
| MO-AB-28672H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28672C | 100 µg | ||
| MO-AB-01290L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01290L | 100 µg | ||
| MO-AB-06852Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06852Y | 100 µg | ||
| MO-AB-17515Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17515Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO09769Y |
| Specificity | This antibody binds to Rabbit RPS27L. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. (From NCBI) |
| Product Overview | This product is a mouse antibody against RPS27L. It can be used for RPS27L detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 40S ribosomal protein S27; LOC100354634 |
| UniProt ID | G1TL29 |
| Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry