AibGenesis™ Mouse Anti-RPS29A Antibody (CBMOAB-03625CR)


Cat: CBMOAB-03625CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03625CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana) WB, ELISA MO03625CR 100 µg
CBMOAB-40708FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO40708FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana)
CloneMO03625CR
SpecificityThis antibody binds to Yeast RPS29A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast RPS29A Antibody is a mouse antibody against RPS29A. It can be used for RPS29A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names40S ribosomal protein S29-A; S36; YS29; RPS29A; RPS36A YS29A; YLR388W
UniProt IDP41057
Protein RefseqThe length of the protein is 56 amino acids long. The sequence is show below: MAHENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFNKFR.
For Research Use Only | Not For Clinical Use.
Online Inquiry