AibGenesis™ Mouse Anti-RPS4Y2 Antibody (CBMOAB-56843FYA)


Cat: CBMOAB-56843FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56843FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO56843FYA 100 µg
MO-AB-13348W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13348W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO56843FYA
SpecificityThis antibody binds to Rhesus RPS4Y2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a ribosomal protein that is highly similar to RPS4Y1. This gene is located in the male-specific region of the Y chromosome. (From NCBI)
Product OverviewMouse Anti-Rhesus RPS4Y2 Antibody is a mouse antibody against RPS4Y2. It can be used for RPS4Y2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names40S ribosomal protein S4; RPS4Y2
UniProt IDB8YE08
Protein RefseqThe length of the protein is 263 amino acids long.
The sequence is show below: MARGPKKHLKRVAAPKHWMLDKLTXVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITAEEAKYKLCKVRKITVGTKGIPHLVTHDARTIRYPDPVIKVNDTVRIDLGSGKITSFIKFDTGNVCMVIGGANLGRVGVITNRERHPGSFDVVHVKDASGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry