AibGenesis™ Mouse Anti-RTP4 Antibody (CBMOAB-56974FYA)


Cat: CBMOAB-56974FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56974FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO56974FYA 100 µg
MO-AB-17543Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17543Y 100 µg
MO-AB-19665R Monoclonal Cattle (Bos taurus) WB, ELISA MO19665R 100 µg
MO-AB-28767H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28767C 100 µg
MO-AB-35619W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35619W 100 µg
MO-AB-63696W Monoclonal Marmoset WB, ELISA MO63696W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO56974FYA
SpecificityThis antibody binds to Rhesus RTP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RTP4 Antibody is a mouse antibody against RTP4. It can be used for RTP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesReceptor-transporting protein 4; RTP4
UniProt IDH9Z1N1
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MVVDIRTWEQTFQELIQEAKPWAKWTLKLDENLQLDCLAQGWKQYQQRAFGWFRCSSCQRSWASAQVQILCHTSWEHWTSQGQVHMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTSKSPEMPVILEVALEGSHDTANCEACTLGICGQGLKSYMTKPSKSPLSHLKTGNSSPGIGAAYIPNQGKNQSAETKEAKGRGYEKLGPSRDPDPLNICVFVLLLVFIIVKCFTSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry