AibGenesis™ Mouse Anti-RUNDC1 Antibody (CBMOAB-56982FYA)


Cat: CBMOAB-56982FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56982FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO56982FYA 100 µg
MO-AB-11201W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11201W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO56982FYA
SpecificityThis antibody binds to Rhesus RUNDC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that contains a RUN (RPIP8, UNC-14 and NESCA) domain and a coiled coil domain. The encoded protein may negatively regulate p53 transcriptional activity. This gene is a potential candidate gene for predisposition to glioma in humans. (From NCBI)
Product OverviewMouse Anti-Rhesus RUNDC1 Antibody is a mouse antibody against RUNDC1. It can be used for RUNDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRUNDC1
UniProt IDF7GZ78
Protein RefseqThe length of the protein is 615 amino acids long.
The sequence is show below: GKMAAVEAAAEPVTVVAAVGPKAKNEEEEEEEPLPPCEAVRWAPVGAVAEAGPGATAFFEETAAEEPGAVPGSPPDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGPGDPASDEGDGLPGDRPRLRGEDQSEQEKQERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEVGSPLQTGGGHCECKARGKTGNGCSRTGSSRPPPGDSRTKAEDVKKVRETGLHLMRRALAVLQIFAVSQFGCATGQIPPTLWQRGQADRDYSPLLKRLEVSVDRVKQLALRQQPHDHVITSANLQDLSLGGKDELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLPAFSSAPEAMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPVTGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDAF.
For Research Use Only | Not For Clinical Use.
Online Inquiry