AibGenesis™ Mouse Anti-S100PBP Antibody (MO-AB-19701R)


Cat: MO-AB-19701R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19701R Monoclonal Cattle (Bos taurus), Marmoset WB, ELISA MO19701R 100 µg
MO-AB-63759W Monoclonal Marmoset WB, ELISA MO63759W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset
CloneMO19701R
SpecificityThis antibody binds to Cattle S100PBP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that was originally identified by its interaction with S100 calcium-binding protein P. Expression of this protein has been reported to be associated with pancreatic ductal adenocarcinoma. Alternatively spliced transcript variants have been described. (From NCBI)
Product OverviewThis product is a mouse antibody against S100PBP. It can be used for S100PBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesS100P-binding protein; S100PBP
UniProt IDQ3MHH3
Protein RefseqThe length of the protein is 422 amino acids long.
The sequence is show below: MMCSLVPSEQSSGTSLLPKDNAPFSWSSLDEDELDDSLLELSDGEDDGHFSFTEEQIQELLKDDDLSNEHFPWGGGLPSDDSRNVEKGEKGSQIPLDTPQEKDSPYNMGPEAETPDTFKLPQLTTSVGHGPTPAKSLNRRFALEKNLIKVTVAPFDPTVCDVALDKDKTYVSEVTSRVTEKPSSLGEEMREDDLSPNESTLCTESEGISPDNSASDGPPLPSSNSNFQHTVSDKNMSDSKKATPVFSQILDHSET.
For Research Use Only | Not For Clinical Use.
Online Inquiry