AibGenesis™ Mouse Anti-saa Antibody (CBMOAB-97000FYA)


Cat: CBMOAB-97000FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97000FYA Monoclonal Zebrafish (Danio rerio), Cat, Cat (Felis catus), Goat, Horse (Equus caballus), O. mykiss (Oncorhynchus mykiss), Rabbit WB, ELISA MO97000FYA 100 µg
MO-AB-13201Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13201Y 100 µg
MO-AB-46429W Monoclonal Horse (Equus caballus) WB, ELISA MO46429W 100 µg
MO-AB-70565W Monoclonal Cat (Felis catus) ELISA, WB 8C6C10 100 µg
MOFAB-460W Monoclonal Cat ELISA W1C12 100 µg
MO-MMB-0716 Monoclonal Cat (Felis catus) ELISA M1C12 100 µg
MOFY-0622-FY223 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY368 Polyclonal Goat WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat, Cat (Felis catus), Goat, Horse (Equus caballus), O. mykiss (Oncorhynchus mykiss), Rabbit
CloneMO97000FYA
SpecificityThis antibody binds to Zebrafish saa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish saa Antibody is a mouse antibody against saa. It can be used for saa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerum amyloid A protein; saa; zgc:10358
UniProt IDQ642J9
Protein RefseqThe length of the protein is 121 amino acids long.
The sequence is show below: MKLLLAVLVMFMVVEAQAQWYRFPGEAAGGAKDMWRAYQHMKEANWKNSDKYFHARGNYEAAQRGPGGYWAAKVISDGREALQGLIRRGNSDAAADQEANLWGRNGGDPNKYRPKGLPIKY.
For Research Use Only | Not For Clinical Use.
Online Inquiry