AibGenesis™ Mouse Anti-samd13 Antibody (CBMOAB-97036FYA)


Cat: CBMOAB-97036FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97036FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO97036FYA 100 µg
MO-AB-28808H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28808C 100 µg
MO-AB-63787W Monoclonal Marmoset WB, ELISA MO63787W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO97036FYA
SpecificityThis antibody binds to Zebrafish samd13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish samd13 Antibody is a mouse antibody against samd13. It can be used for samd13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:153376; samd13; zgc:153376; NP_001070207.1;NP_001161789.
UniProt IDQ08C88
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: METKENGSVETKNSVENGQLTDPAHWAVADVVNYFKATGFEEQANAFQDQEIDGKSLLLMTRNDVLTGLSIKLGPALKIYEYHVKPLQTQHLKSNVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry