AibGenesis™ Mouse Anti-SAPCD1 Antibody (MO-AB-05794W)


Cat: MO-AB-05794W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05794W Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO05794W 100 µg
MO-AB-28823H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28823C 100 µg
MO-AB-63806W Monoclonal Marmoset WB, ELISA MO63806W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO05794W
SpecificityThis antibody binds to Rhesus SAPCD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SAPCD1 Antibody is a mouse antibody against SAPCD1. It can be used for SAPCD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuppressor APC Domain Containing 1; Protein G7d; C6orf26; NG23; Suppressor APC Domain-Containing Protein 1; Chromosome 6 Open Reading Frame 26; G7D
UniProt IDG7MRK2
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MGSQGSGGMPLVQVPYTVLLLPLGTSRQDPGARSFFLWLRRMQALEREQDALWQGLELLQHGQAWFEDRLKEAQQQQLHLGALGENFLTDLHSEPGGPPLAQIQKVNICLQNLIHEKFSPSPLNKASSCTTQDSKERRRKQNLWRQQELSRQQKGVTQPKEEMAQRGCTNGPRGPTRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry