AibGenesis™ Mouse Anti-SBK1 Antibody (CBMOAB-57143FYA)


Cat: CBMOAB-57143FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57143FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Marmoset, O. anatinus (Ornithorhynchus anatinus), Zebrafish (Danio rerio) WB, ELISA MO57143FYA 100 µg
CBMOAB-97127FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97127FYA 100 µg
MO-AB-01324L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01324L 100 µg
MO-AB-03898Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03898Y 100 µg
MO-AB-06862Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06862Y 100 µg
MO-AB-33230W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33230W 100 µg
MO-AB-63842W Monoclonal Marmoset WB, ELISA MO63842W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Marmoset, O. anatinus (Ornithorhynchus anatinus), Zebrafish (Danio rerio)
CloneMO57143FYA
SpecificityThis antibody binds to Rhesus SBK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SBK1 Antibody is a mouse antibody against SBK1. It can be used for SBK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine/threonine-protein kinase SBK1; SBK1
UniProt IDH9F0Q7
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: MSMGCPEPEPPRSLTCCGPGAAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry