AibGenesis™ Mouse Anti-SCARA5 Antibody (CBMOAB-57182FYA)


Cat: CBMOAB-57182FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57182FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) WB, ELISA MO57182FYA 100 µg
CBMOAB-97202FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97202FYA 100 µg
MO-AB-13216Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13216Y 100 µg
MO-AB-16393W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16393W 100 µg
MO-AB-19763R Monoclonal Cattle (Bos taurus) WB, ELISA MO19763R 100 µg
MO-AB-63873W Monoclonal Marmoset WB, ELISA MO63873W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio)
CloneMO57182FYA
SpecificityThis antibody binds to Rhesus SCARA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SCARA5 Antibody is a mouse antibody against SCARA5. It can be used for SCARA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCARA5
UniProt IDF7EJY3
Protein RefseqThe length of the protein is 493 amino acids long.
The sequence is show below: MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASSCCTQLGSLSALKHAVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAEAFLMPPETGLRVPYGILFPLQMTWSCSRRQLPNLSAVFAFPGPPGPKGDQGDEGKEGRPGIPGLPGLRGNGHAPGRDLRDPQSISTTYFLDGINARAAQGSTQSTPPQTLCSNKRLRGCWCHDGMQHILFLQVPQSEGKGYSTGPKLPEGVRGVGPCGPVGLCCLPGERGTPGLPGPKGDDGKLGATGPMGMRGFKGERGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDDGWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVTNCGHAEDASVTCNRH.
For Research Use Only | Not For Clinical Use.
Online Inquiry