AibGenesis™ Mouse Anti-SCRN1 Antibody (CBMOAB-57264FYA)


Cat: CBMOAB-57264FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57264FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO57264FYA 100 µg
MO-AB-05826W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05826W 100 µg
MO-AB-19823R Monoclonal Cattle (Bos taurus) WB, ELISA MO19823R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO57264FYA
SpecificityThis antibody binds to Rhesus SCRN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SCRN1 Antibody is a mouse antibody against SCRN1. It can be used for SCRN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCRN1
UniProt IDF7CYS6
Protein RefseqThe length of the protein is 412 amino acids long.
The sequence is show below: MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEQESKVECTYISVDQVPRTHAIMISRPAWLWGAEMGANEHGVCIANEAVNTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQGGNYYEDANSCHSFQSAYLIVDRDEAWVLETVGKYWAAEKVTEGVRCICNRLSLTTKMDAEHPELRSYAQSQGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSESFLTTASGVSVLPQNRSAPCIHYFTGTPDPSRFVRGLVTTSEETKNKSKPKDPSFLGGSFSDHSLKKKKKKKRQTSCSARWLLAPVLSQAEQGRKLRSTMLELEKQGLEAMEEILTSSGPLDPAEVGDLFYDCVDTEIKFFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry