AibGenesis™ Mouse Anti-scx Antibody (MO-AB-07464H)


Cat: MO-AB-07464H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07464H Monoclonal Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO07464C 100 µg
MO-AB-28877H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28877C 100 µg
MO-AB-46476W Monoclonal Horse (Equus caballus) WB, ELISA MO46476W 100 µg
MO-AB-63971W Monoclonal Marmoset WB, ELISA MO63971W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO07464C
SpecificityThis antibody binds to Frog scx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against scx. It can be used for scx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesScleraxis; scx; Scx scxa
UniProt IDA5H9T7
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MSFAMLSHAPPGRFLYPEISPMSDEEEEESANDSSECEDKSFLHSAERLAKRAEKRCHRLHREPRQRHSANARERDRTNSVNGAFTALRTLIPTEPQDRKLSKIETLRLASSYISHLGNVLLLGDTCGDGQPCHNQYYPHSSAASPKHPDSQQPKLICTFCLSNQRKMGKDKERKTAIRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry