AibGenesis™ Mouse Anti-SDHAF1 Antibody (CBMOAB-57298FYA)


Cat: CBMOAB-57298FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57298FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO57298FYA 100 µg
CBMOAB-97384FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97384FYA 100 µg
MO-AB-19855R Monoclonal Cattle (Bos taurus) WB, ELISA MO19855R 100 µg
MO-AB-24454W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24454W 100 µg
MO-AB-28886H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28886C 100 µg
MO-AB-35649W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35649W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO57298FYA
SpecificityThis antibody binds to Rhesus SDHAF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe succinate dehydrogenase (SDH) complex (or complex II) of the mitochondrial respiratory chain is composed of 4 individual subunits. The protein encoded by this gene resides in the mitochondria, and is essential for SDH assembly, but does not physically associate with the complex in vivo. Mutations in this gene are associated with SDH-defective infantile leukoencephalopathy (mitochondrial complex II deficiency). (From NCBI)
Product OverviewMouse Anti-Rhesus SDHAF1 Antibody is a mouse antibody against SDHAF1. It can be used for SDHAF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuccinate dehydrogenase assembly factor 1, mitochondrial; SDHAF1
UniProt IDH9F4S7
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: RLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTEEPGGVGSQPDDGDGPRNPHDSTGAPETRPDGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry