AibGenesis™ Mouse Anti-SDHAF2 Antibody (CBMOAB-11704HCB)
Cat: CBMOAB-11704HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-11704HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Hamsters (Cricetinae), Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO11704HB | 100 µg | ||
| CBMOAB-97385FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO97385FYA | 100 µg | ||
| MO-AB-01349L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01349L | 100 µg | ||
| MO-AB-08129W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08129W | 100 µg | ||
| MO-AB-09865Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09865Y | 100 µg | ||
| MO-AB-13224Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13224Y | 100 µg | ||
| MO-AB-14231W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14231W | 100 µg | ||
| MO-AB-17581Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17581Y | 100 µg | ||
| MO-AB-19856R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19856R | 100 µg | ||
| MO-AB-28887H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28887C | 100 µg | ||
| MO-AB-29016R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO29016R | 100 µg | ||
| MO-AB-33264W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33264W | 100 µg | ||
| MO-AB-33757H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33757C | 100 µg | ||
| MO-AB-35650W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35650W | 100 µg | ||
| MO-AB-38159W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38159W | 100 µg | ||
| MO-AB-43423W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43423W | 100 µg | ||
| MO-AB-46484W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46484W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Hamsters (Cricetinae), Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO11704HB |
| Specificity | This antibody binds to C. elegans SDHAF2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit of the SDH catalytic dimer. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-C. elegans SDHAF2 Antibody is a mouse antibody against SDHAF2. It can be used for SDHAF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Succinate dehydrogenase assembly factor 2, mitochondrial; SDH assembly factor 2; sdhaf-2 |
| UniProt ID | Q9NA72 |
| Protein Refseq | The length of the protein is 119 amino acids long. The sequence is show below: MTSRILQRFFTVSTSLRSLTRAEVPGEKIDAKRARLLYQSKKRGILENDILLGDFAEQNLKKMSEPELKAYDKLINGEHMEWDLFYYLSNKKSPPEDVESCQVYQKVKKFVDDKRVPKS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry