AibGenesis™ Mouse Anti-sec11a Antibody (CBMOAB-97420FYA)


Cat: CBMOAB-97420FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97420FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO97420FYA 100 µg
MO-AB-07478H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07478C 100 µg
MO-AB-19876R Monoclonal Cattle (Bos taurus) WB, ELISA MO19876R 100 µg
MO-AB-20283W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20283W 100 µg
MO-AB-28895H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28895C 100 µg
MO-AB-33267W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33267W 100 µg
MO-AB-64002W Monoclonal Marmoset WB, ELISA MO64002W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO97420FYA
SpecificityThis antibody binds to Zebrafish sec11a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. (From NCBI)
Product OverviewMouse Anti-Zebrafish sec11a Antibody is a mouse antibody against sec11a. It can be used for sec11a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSEC11 homolog A; S. cerevisiae; sec11a; sec1
UniProt IDQ6DGR3
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPALHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNSVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLCLLGLFVLVHRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry