AibGenesis™ Mouse Anti-SEC14L1 Antibody (CBMOAB-57323FYA)


Cat: CBMOAB-57323FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57323FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO57323FYA 100 µg
CBMOAB-97424FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97424FYA 100 µg
MO-AB-05837W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05837W 100 µg
MO-AB-07481H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07481C 100 µg
MO-AB-19879R Monoclonal Cattle (Bos taurus) WB, ELISA MO19879R 100 µg
MO-AB-26274W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26274W 100 µg
MO-AB-64005W Monoclonal Marmoset WB, ELISA MO64005W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO57323FYA
SpecificityThis antibody binds to Rhesus SEC14L1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene; some variants represent read-through transcripts that include exons from the upstream gene C17orf86. (From NCBI)
Product OverviewMouse Anti-Rhesus SEC14L1 Antibody is a mouse antibody against SEC14L1. It can be used for SEC14L1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSEC14L1
UniProt IDF7AHW6
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFRCGRSPHSRCCGRLGVVGGRLQSHAVCRISSGVGFRGCSGDQEGVAWGSFVGTVTPCMSAEGECQRQSRLAFAFAHAAVCVQAVGSRPPGWVTQVHPPFASTDGVEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry