AibGenesis™ Mouse Anti-SEC22C Antibody (CBMOAB-57336FYA)


Cat: CBMOAB-57336FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57336FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO57336FYA 100 µg
CBMOAB-97436FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97436FYA 100 µg
MO-AB-07488H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07488C 100 µg
MO-AB-19887R Monoclonal Cattle (Bos taurus) WB, ELISA MO19887R 100 µg
MO-AB-24221W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24221W 100 µg
MO-AB-64012W Monoclonal Marmoset WB, ELISA MO64012W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO57336FYA
SpecificityThis antibody binds to Rhesus SEC22C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the SEC22 family of vesicle trafficking proteins. The encoded protein is localized to the endoplasmic reticulum and may play a role in the early stages of ER-Golgi protein trafficking. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus SEC22C Antibody is a mouse antibody against SEC22C. It can be used for SEC22C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSEC22C
UniProt IDF7HTH5
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MSMIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGRDFSIHFSSFGDVACMAICSCQCPATMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDNIIQKVKWHFNYVSSSQMESSLEKIQEELKLQPPVVLTLEDTDVANGVMNGHIPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQDPGSWFCWLDQTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry