AibGenesis™ Mouse Anti-sec61g Antibody (CBMOAB-97466FYA)
Cat: CBMOAB-97466FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-97466FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO97466FYA | 100 µg | ||
| MO-AB-05843W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05843W | 100 µg | ||
| MO-AB-15244W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15244W | 100 µg | ||
| MO-AB-19895R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19895R | 100 µg | ||
| MO-AB-28901H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28901C | 100 µg | ||
| MO-AB-33273W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33273W | 100 µg | ||
| MO-AB-64041W | Monoclonal | Marmoset | WB, ELISA | MO64041W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO97466FYA |
| Specificity | This antibody binds to Zebrafish sec61g. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the gamma-subunit protein. Alternatively spliced transcript variants encoding the same protein have been identified. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish sec61g Antibody is a mouse antibody against sec61g. It can be used for sec61g detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | sec61g; Sec61 Translocon Gamma Subunit |
| UniProt ID | F2Z4R1 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry