AibGenesis™ Mouse Anti-SEH1L Antibody (CBMOAB-57356FYA)


Cat: CBMOAB-57356FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57356FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO57356FYA 100 µg
CBMOAB-97481FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97481FYA 100 µg
MO-AB-05844W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05844W 100 µg
MO-AB-17349W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17349W 100 µg
MO-AB-19899R Monoclonal Cattle (Bos taurus) WB, ELISA MO19899R 100 µg
MO-AB-64045W Monoclonal Marmoset WB, ELISA MO64045W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO57356FYA
SpecificityThis antibody binds to Rhesus SEH1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including this protein, specifically localize to kinetochores in mitosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus SEH1L Antibody is a mouse antibody against SEH1L. It can be used for SEH1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSEH1L
UniProt IDF7H1B5
Protein RefseqThe length of the protein is 360 amino acids long.
The sequence is show below: MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKDNHIQNYSLYWYLKGNGSPVNGSSQQGNSNPSLGSNIPSLQNSLNGSSAGRKHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry