AibGenesis™ Mouse Anti-SERF1A Antibody (MO-AB-13340W)


Cat: MO-AB-13340W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13340W Monoclonal Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO13340W 100 µg
MO-AB-64133W Monoclonal Marmoset WB, ELISA MO64133W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset
CloneMO13340W
SpecificityThis antibody binds to Chimpanzee SERF1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee SERF1A Antibody is a mouse antibody against SERF1A. It can be used for SERF1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall EDRK-rich factor 1A; Telomeric; SERF1B; SERF1A
UniProt IDH2R089
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKVSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI.
For Research Use Only | Not For Clinical Use.
Online Inquiry