AibGenesis™ Mouse Anti-SETD8 Antibody (MO-AB-13350W)


Cat: MO-AB-13350W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13350W Monoclonal Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO13350W 100 µg
MO-AB-64198W Monoclonal Marmoset WB, ELISA MO64198W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset
CloneMO13350W
SpecificityThis antibody binds to Chimpanzee SETD8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee SETD8 Antibody is a mouse antibody against SETD8. It can be used for SETD8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSET domain containing (Lysine methyltransferase) 8; SETD8
UniProt IDH2Q758
Protein RefseqThe length of the protein is 352 amino acids long.
The sequence is show below: MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARRGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH.
For Research Use Only | Not For Clinical Use.
Online Inquiry