Mouse Anti-Sheep MMP9 Antibody (MO-AB-16176Y)
Cat: MO-AB-16176Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO16176Y |
Specificity | This antibody binds to Sheep MMP9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP''s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. [provided by RefSeq, Jul 2008] |
Product Overview | This product is a mouse antibody against MMP9. It can be used for MMP9 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Matrix metallopeptidase 9; MMP9 |
UniProt ID | B6V724 |
Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFEGRTYSACTSDGRSDGYRWCATTANY. |
See other products for " mmp9 "
MO-AB-05241H | Mouse Anti-Frog mmp9 Antibody (MO-AB-05241H) |
MO-AB-15881R | Mouse Anti-Cattle MMP9 Antibody (MO-AB-15881R) |
MOFY-0722-FY150 | Rabbit Anti-MMP9 Antibody (MOFY-0722-FY150) |
MO-AB-31810W | Mouse Anti-Dog MMP9 Antibody (MO-AB-31810W) |
CBMOAB-87134FYA | Mouse Anti-Zebrafish mmp9 Antibody (CBMOAB-87134FYA) |
MO-AB-12095Y | Mouse Anti-O. mykiss mmp9 Antibody (MO-AB-12095Y) |
MOFY-0622-FY225 | Guinea pig Anti-MMP9 Antibody (MOFY-0622-FY225) |
MO-AB-08851Y | Mouse Anti-Rabbit MMP9 Antibody (MO-AB-08851Y) |
MO-AB-27343R | Mouse Anti-Pig MMP9 Antibody (MO-AB-27343R) |
MO-NAB-00462W | Mouse Anti-Zebrafish MMP9 Antibody (C-terminal) |
For Research Use Only | Not For Clinical Use.
Online Inquiry