Mouse Anti-Sheep MOCS2 Antibody (MO-AB-16178Y)
Cat: MO-AB-16178Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO16178Y |
Specificity | This antibody binds to Sheep MOCS2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin. |
Product Overview | This product is a mouse antibody against MOCS2. It can be used for MOCS2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Molybdopterin synthase sulfur carrier subunit; Molybdenum cofactor synthesis protein 2 small subunit; Molybdenum cofactor synthesis protein 2A; Sulfur carrier protein MOCS2A; MOCS2 |
UniProt ID | W5PE77 |
Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MVPRCQVEVLYFAKSAEIAGIRSETISVPQEIKALQLWNEIEAHHPGLADVRNQVIFAVRQEYVELGDQLLLLQSGDEIAVIPPISGG. |
See other products for " MOCS2 "
MO-AB-38614W | Mouse Anti-Gorilla MOCS2 Antibody (MO-AB-38614W) |
MO-AB-43285W | Mouse Anti-Hamsters MOCS2 Antibody (MO-AB-43285W) |
MO-AB-24689W | Mouse Anti-Chimpanzee MOCS2 Antibody (MO-AB-24689W) |
CBMOAB-34678FYB | Mouse Anti-Rice MOCS2 Antibody (CBMOAB-34678FYB) |
MO-AB-12100Y | Mouse Anti-O. mykiss MOCS2 Antibody (MO-AB-12100Y) |
MO-AB-59218W | Mouse Anti-Marmoset MOCS2 Antibody (MO-AB-59218W) |
CBMOAB-87185FYA | Mouse Anti-Zebrafish mocs2 Antibody (CBMOAB-87185FYA) |
MO-AB-15904R | Mouse Anti-Cattle MOCS2 Antibody (MO-AB-15904R) |
CBMOAB-24452FYA | Mouse Anti-D. melanogaster Mocs2 Antibody (CBMOAB-24452FYA) |
MO-AB-70053W | Mouse Anti-Silkworm Mocs2 Antibody (MO-AB-70053W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry