AibGenesis™ Mouse Anti-SHISAL2B Antibody (MO-AB-20109R)


Cat: MO-AB-20109R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20109R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO20109R 100 µg
MO-AB-28976H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28976C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO20109R
SpecificityThis antibody binds to Cattle SHISAL2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against SHISAL2B. It can be used for SHISAL2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMembrane protein FAM159B; FAM159B
UniProt IDA6QQ93
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MSEASRVCSGYYSLNHSFVEPFQCPRRGEGATLLYCCGFADLKYCCSEPGSYFPYKHSYMWSLSIGALIGLGIAALVLLAFVISVCVLCYLFLYTKPQRLDTGLKLQHLEAVSTQEGNSNRKSKAPRSNAASNSTNETFYEADDIIQEKTMDTTQINTAYC.
For Research Use Only | Not For Clinical Use.
Online Inquiry