AibGenesis™ Mouse Anti-Shmt Antibody (MO-AB-03095W)


Cat: MO-AB-03095W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03095W Monoclonal WB, ELISA MO03095W 100 µg
MO-AB-17087H Monoclonal Malaria parasite WB, ELISA MO17087C 100 µg
MO-AB-29091R Monoclonal Pig (Sus scrofa) WB, ELISA MO29091R 100 µg
MO-AB-32593H Monoclonal Soybean (Glycine max) WB, ELISA MO32593C 100 µg
MO-DKB-02214W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MO-DKB-0500RA Polyclonal WB 500 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); B. oleracea (Brassica oleracea); Rice (Oryza); P. sativum (Pisum sativum); Spinach (Spinacia oleracea); V. faba (Vicia faba), Malaria parasite, Pig (Sus scrofa), Soybean (Glycine max)
CloneMO03095W
SpecificityThis antibody binds to Fruit fly Shmt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Cytosol; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSerine hydroxymethyltransferase (SHMT) catalyzes the reversible conversion of serine and tetrahydrofolate (THF) to glycine and 5,10-methylene THF. The Arabidopsis genome contains seven genes (SHM1 to SHM7). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Fruit fly Shmt Antibody is a mouse antibody against Shmt. It can be used for Shmt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine hydroxymethyltransferase; EC 2.1.2.1; Shmt
UniProt IDQ9W457
Protein RefseqThe length of the protein is 537 amino acids long.
The sequence is show below: MQRARSTLTQKLRFCLSRDLNTKVGNPVNFETGKLSGALTRIAAKKQPSPTPFLPAIRRYSDSKQSTLKNMADQKLLQTPLAQGDPELAELIKKEKERQREGLEMIASENFTSVAVLESLSSCLTNKYSEGYPGKRYYGGNEYIDRIELLAQQRGRELFNLDDEKWGVNVQPYSGSPANLAVYTGVCRPHDRIMGLDLPDGGHLTHGFFTPTKKISATSIFFESMPYKVNPETGIIDYDKLAEAAKNFRPQIIIAGISCYSRLLDYARFRQICDDVGAYLMADMAHVAGIVAAGLIPSPFEWADIVTTTTHKTLRGPRAGVIFFRKGVRSTKANGDKVLYDLEERINQAVFPSLQGGPHNNAVAGIATAFKQAKSPEFKAYQTQVLKNAKALCDGLISRGYQVATGGTDVHLVLVDVRKAGLTGAKAEYILEEVGIACNKNTVPGDKSAMNPSGIRLGTPALTTRGLAEQDIEQVVAFIDAALKVGVQAAKLAGSPKITDYHKTLAENVELKAQVDEIRKNVAQFSRKFPLPGLETL.
For Research Use Only | Not For Clinical Use.
Online Inquiry