AibGenesis™ Mouse Anti-si:ch211-275j6.5 Antibody (CBMOAB-00594FYB)


Cat: CBMOAB-00594FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00594FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO00594FYB 100 µg
CBMOAB-61359FYC Monoclonal Zebrafish (Danio rerio) WB, ELISA MO61359FYC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO00594FYB
SpecificityThis antibody binds to Zebrafish si:ch211-275j6.5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay act as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion. May help rescuing stalled mitoribosomes during translation.In contrast to other members of the family, lacks the regions that come into close contact with the mRNA in the ribosomal A-site and determine the STOP codon specificity, suggesting a loss of codon specificity for translation release factor activity. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish si:ch211-275j6.5 Antibody is a mouse antibody against si:ch211-275j6.5. It can be used for si:ch211-275j6.5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessi:ch211-275j6.5
UniProt IDZ4YJA1
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: MDIGWPSVLPAAGKKYQIELPVVHEEELEEQFVRGSGPGGQATNKTSNCVVLRHIPSGIVVKCHETRSVDLNRKRAREILREKLEVAYKGEESELLKMKKESMQKKQDKRRKVNENIEKKRRFKEMLNSKQEDDKST.
For Research Use Only | Not For Clinical Use.
Online Inquiry