AibGenesis™ Mouse Anti-siat6 Antibody (MO-AB-01569R)


Cat: MO-AB-01569R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01569R Monoclonal Medaka (Oryzias latipes), Cattle (Bos taurus), Chicken (Gallus gallus) WB, ELISA MO01569R 100 µg
MO-AB-03962Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03962Y 100 µg
MO-AB-20124R Monoclonal Cattle (Bos taurus) WB, ELISA MO20124R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes), Cattle (Bos taurus), Chicken (Gallus gallus)
CloneMO01569R
SpecificityThis antibody binds to Medaka siat6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against siat6. It can be used for siat6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-2,3-sialyltransferase ST3Gal III; EC 2.4.99.6; siat6
UniProt IDQ5ND64
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: MKATHKLLFILCPVLVLGFIYYSSWKLHIYIWVQKPLYDKQGFLMQLDTPLSPDLMYKYGNLSEGACKPGYAAAKMTSIYPKFMKLAPMFLDPNFKRLGKVSGYMPPFGFKTQEKLISSILSETKYYGLGEHLDSLSCKRCIIVGNGGILSNKSLGSRIDQYDVVIRLNEAPVKGYSKDVGSKTTMRITYPEGAIQKPENYEDNSLFVFSAFKPLDFKWLKQMVYKEKVRGMEGFWKSVAQYVPRAPADMRILNPYFIQEAAFQFIGLPFNNGLMGKGNIPTLGTVAITMALHNCDEVAVAGFGYDMNMPYAPLHYYETVRMSTIKESWTHNIPKEKEFLRKLVKANVITDLTNGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry