AibGenesis™ Mouse Anti-siat7c Antibody (MO-AB-01571R)


Cat: MO-AB-01571R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01571R Monoclonal Medaka (Oryzias latipes), Chicken (Gallus gallus) WB, ELISA MO01571R 100 µg
MO-AB-03964Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03964Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes), Chicken (Gallus gallus)
CloneMO01571R
SpecificityThis antibody binds to Medaka siat7c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against siat7c. It can be used for siat7c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha 2,6 sialyltransferase III; EC 2.4.99.7; siat7c
UniProt IDQ5K025
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MHCSKRRNYLTWLWKTFHQLCKCVYFWCPCHENCVRIKHRLSPSQRKSFIATSLVVAVTLLVVVVTNSEKSNFLQLPVFGQTFNSDWMFSKQTYKVFKPHQGYTSIPKEEPLELHCDLCTIVSSSGQMLGQGAGPQIDRSPCVFRTNNAPTAGFEMDVGRRTTVRVVSHTSVPLLLQKPQYFFGQENETTYVVWGPLRNMRKDGKGIVYNMLQQASEKYPRARIYITTDERMNYCDTVFKKETGKDRVQSGSYLSTGWFTLILAMDMCKEIHIYGMINDTYCKLESKRTVPYHYYEAGSRDECAEYLLHENAPHGGHRFITEKAVFAKWAKTHPIKFFKPSWQLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry