Mouse Anti-Silkworm Smt3 Antibody (MO-AB-70419W)


Cat: MO-AB-70419W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO70419W
SpecificityThis antibody binds to Silkworm Smt3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe covalent modification of target lysine by SUMO (small ubiquitin-like modifier) can regulate protein localization, transcription, nuclear transport, mitosis, DNA replication and repair, signal transduction, and virus reproduction. SUMO does not seem to be involved in protein degradation, and may actually act as an antagonist of ubiquitin during the degradation process. During the development of Drosophila, SUMO plays a maternal role in front and back (A/P) polarity and patterns.
Product OverviewMouse Anti-Silkworm Smt3 Antibody is a mouse antibody against Smt3. It can be used for Smt3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall ubiquitin-related modifier; SUMO; Smt3; sumo
UniProt IDQ2VEW6
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: MADEKKGENEHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGVSLV.
See other products for " SMT3 "
MO-AB-00924HMouse Anti-Arabidopsis SMT3 Antibody (MO-AB-00924H)
CBMOAB-41542FYCMouse Anti-Arabidopsis SMT3 Antibody (CBMOAB-41542FYC)
MO-DKB-03947WRabbit Anti-SMT3 (AA 2-98) Antibody (Cat MO-DKB-03947W)
MO-DKB-03783WRabbit Anti-SMT3 Antibody (Cat MO-DKB-03783W)
MO-DKB-03782WRabbit Anti-SMT3 Antibody (Cat MO-DKB-03782W)
MOFY-0922-FY62Mouse Anti-Smt3 (AA 15-98) Antibody, IgG1 kappa (MOFY-0922-FY62)
MORAB-018FAnti-SMT3 Antibody (Cat MORAB-018F), Mouse IgG
CBMOAB-04052CRMouse Anti-Yeast SMT3 Antibody (CBMOAB-04052CR)
CBMOAB-31375FYAMouse Anti-D. melanogaster Smt3 Antibody (CBMOAB-31375FYA)
MOFY-0922-FY63Mouse Anti-Smt3 (AA 15-98) Antibody, IgG2b kappa (MOFY-0922-FY63)
For Research Use Only | Not For Clinical Use.
Online Inquiry