AibGenesis™ Mouse Anti-SIX6 Antibody (CBMOAB-57832FYA)


Cat: CBMOAB-57832FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57832FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO57832FYA 100 µg
MO-AB-05989W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05989W 100 µg
MO-AB-07652H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07652C 100 µg
MO-AB-20158R Monoclonal Cattle (Bos taurus) WB, ELISA MO20158R 100 µg
MO-AB-28988H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28988C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO57832FYA
SpecificityThis antibody binds to Rhesus SIX6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in eye development. Defects in this gene are a cause of isolated microphthalmia with cataract type 2 (MCOPCT2). (From NCBI)
Product OverviewMouse Anti-Rhesus SIX6 Antibody is a mouse antibody against SIX6. It can be used for SIX6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSIX6
UniProt IDF7H037
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: PPVRAARSRPLRHRRHQSCVPAAPIRLIDKSLAHSARPAGICCVSRSGLSALAAAGAASMFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGASEVLGVAASPAASLSSKAATSAISITSSDSECDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry