AibGenesis™ Mouse Anti-skap2 Antibody (CBMOAB-05459FYB)
Cat: CBMOAB-05459FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-05459FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset | WB, ELISA | MO05459FYB | 100 µg | ||
| MO-AB-20169R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20169R | 100 µg | ||
| MO-AB-21686W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21686W | 100 µg | ||
| MO-AB-64421W | Monoclonal | Marmoset | WB, ELISA | MO64421W | 100 µg | ||
| MO-DKB-01217W | Polyclonal | Human (Homo sapiens), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset |
| Clone | MO05459FYB |
| Specificity | This antibody binds to Zebrafish skap2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating proper activation of the immune system. This protein contains an amino terminal coiled-coil domain for self-dimerization, a plecskstrin homology (PH) domain required for interactions with lipids at the membrane, and a Src homology (SH3) domain at the carboxy terminus. Some reports indicate that this protein inhibits actin polymerization through interactions with actin assembly factors, and might negatively regulate the invasiveness of tumors by modulating actin assembly. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish skap2 Antibody is a mouse antibody against skap2. It can be used for skap2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Src kinase-associated phosphoprotein 2; Src family-associated phosphoprotein 2; skap2; scap |
| UniProt ID | Q6PG29 |
| Protein Refseq | The length of the protein is 341 amino acids long. The sequence is show below: MRSVPEDFTTLISDLETFLTDVLKGENLSKKAKEKKDAFIKRIKDVKTSYAQEFKDRRDEEFPEPDEADTNDGGSLHSEQTDRDDENAYDGVQQSPPVAAQDLQAVLKSGYLEKRRKDHSFFGNEWQKRWCALNNSIFYYYGSEKDKQQKGEFNIVGYTVKMNNTLRKDAKRDCCFEVSAPDKRVYQFCAASEKEAKEWVEHIDFLIKDLGGIIPEDEEEYDDCLSMSQSEVAILPDDDIYEELPEEDVPQPSKPKVTLVNKPPPPATPVTAAVNKSTDYANYFQGLWDCIGDQPDELSFKRGDTIYILSKEYDMFGWWVGEMKGVIGIVPKEYLLELYVL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry