AibGenesis™ Mouse Anti-SLC23A2 Antibody (MO-AB-20271R)


Cat: MO-AB-20271R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20271R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO20271R 100 µg
MO-AB-20544W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20544W 100 µg
MO-AB-33352W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33352W 100 µg
MO-AB-64521W Monoclonal Marmoset WB, ELISA MO64521W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset
CloneMO20271R
SpecificityThis antibody binds to Cattle SLC23A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1. (From NCBI)
Product OverviewThis product is a mouse antibody against SLC23A2. It can be used for SLC23A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSolute carrier family 23 (Nucleobase transporters), member 2; SLC23A2
UniProt IDQ3SZN9
Protein RefseqThe length of the protein is 461 amino acids long.
The sequence is show below: MNSAITTCEHPNPLRGDGVLSSHEGDQGSKKDGQLKSPSSSHMAYGILDIPPWYLCIFLGIQHFLTALGGLVAVPLILAKDLCLQHDPLTQSYLISTTFFVSGICTLLQVLLGIRLPILQGGTFAFLGPSLAMLSLPTWKCPEWTLNASQVNTSSPEFTEEWQKRIRELQGAVLVASCVQMLVGFSGLIGFLMRFIGPLTIAPTISLMALPLFDPAGDDAGIHWGIAATTIFLIVLFSQYLKNIAVPVPIYGREK.
For Research Use Only | Not For Clinical Use.
Online Inquiry