AibGenesis™ Mouse Anti-slc25a19 Antibody (CBMOAB-05735FYB)
Cat: CBMOAB-05735FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-05735FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO05735FYB | 100 µg | ||
| CBMOAB-58039FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO58039FYA | 100 µg | ||
| MO-AB-17658Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17658Y | 100 µg | ||
| MO-AB-20287R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20287R | 100 µg | ||
| MO-AB-26055W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26055W | 100 µg | ||
| MO-AB-30073R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30073R | 100 µg | ||
| MO-AB-64543W | Monoclonal | Marmoset | WB, ELISA | MO64543W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
| Clone | MO05735FYB |
| Specificity | This antibody binds to Zebrafish slc25a19. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein instead functions as the mitochondrial thiamine pyrophosphate carrier, which transports thiamine pyrophosphates into mitochondria. Mutations in this gene cause microcephaly, Amish type, a metabolic disease that results in severe congenital microcephaly, severe 2-ketoglutaric aciduria, and death within the first year. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish slc25a19 Antibody is a mouse antibody against slc25a19. It can be used for slc25a19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Solute carrier family 25 member 19; slc25a1 |
| UniProt ID | Q6TLF4 |
| Protein Refseq | The length of the protein is 313 amino acids long. The sequence is show below: MVGYDPNSPSVSLAPEEAALAGSAAGIVTRALISPLDVVKIRFQLQIEKVSWRSRQGKYWGLWQATRCILTEEGLPAFWKGHIPAQLLSVCYGAVQFASFEVLTELVHKKTPYNSQTAGVHFICGGLAACSATVACQPLDTLRTRFAAQGEPKIYRNLRHAIGTMLRSGGPFTFYRGLTPTLVAVFPYAGLQFFFYNILKKLLEHQDTKSKAGLHSLISGSCAGVISKTLTYPFDLIKKRLQVGGFEEARLKFGEVRTYHGFVDCVLRIGREEGPRGFFKGLSPSLLKAALSTGFTFFWYEFFISAIVSLKSR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry