AibGenesis™ Mouse Anti-slc25a29 Antibody (CBMOAB-05764FYB)


Cat: CBMOAB-05764FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05764FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO05764FYB 100 µg
CBMOAB-58052FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58052FYA 100 µg
MO-AB-07700H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07700C 100 µg
MO-AB-12554W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12554W 100 µg
MO-AB-20295R Monoclonal Cattle (Bos taurus) WB, ELISA MO20295R 100 µg
MO-AB-64557W Monoclonal Marmoset WB, ELISA MO64557W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO05764FYB
SpecificityThis antibody binds to Zebrafish slc25a29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear-encoded mitochondrial protein that is a member of the large family of solute carrier family 25 (SLC25) mitochondrial transporters. The members of this superfamily are involved in numerous metabolic pathways and cell functions. This gene product was previously reported to be a mitochondrial carnitine-acylcarnitine-like (CACL) translocase (PMID:128829710) or an ornithine transporter (designated ORNT3, PMID:19287344), however, a recent study characterized the main role of this protein as a mitochondrial transporter of basic amino acids, with a preference for arginine and lysine (PMID:24652292). Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish slc25a29 Antibody is a mouse antibody against slc25a29. It can be used for slc25a29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesslc25a29; Solute Carrier Family 25 Member 29
UniProt IDF1QHQ1
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MDFLAGCIGGAAGVLVGHPFDTVKVRLQVQSVDKPLYRGTFHCFQSIIRQESVLGLYKGIGSPMMGLTFINAIVFGVQGNAMRRLGEDTPLNQFLAGAAAGSIQCVICCPMELAKTRMQMQGTGEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTRSLGCEPDDPYMIPKLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIQREGFRVFTRGLTSTLLRAFPVNAATFATVTLFLLYVRPDEGSKDCEAAHHATLQQQAQPSSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry