AibGenesis™ Mouse Anti-SLC25A3 Antibody (CBMOAB-58053FYA)


Cat: CBMOAB-58053FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58053FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO58053FYA 100 µg
MO-AB-07701H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07701C 100 µg
MO-AB-17320W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17320W 100 µg
MO-AB-17659Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17659Y 100 µg
MO-AB-20296R Monoclonal Cattle (Bos taurus) WB, ELISA MO20296R 100 µg
MO-AB-30075R Monoclonal Pig (Sus scrofa) WB, ELISA MO30075R 100 µg
MO-AB-33358W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33358W 100 µg
MO-AB-64558W Monoclonal Marmoset WB, ELISA MO64558W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO58053FYA
SpecificityThis antibody binds to Rhesus SLC25A3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. (From NCBI)
Product OverviewMouse Anti-Rhesus SLC25A3 Antibody is a mouse antibody against SLC25A3. It can be used for SLC25A3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC25A3
UniProt IDF6TUD5
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: MFSSVAHLARANPFNTPHLQLLHDGLGDLRSNPPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFIAGYIGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry