AibGenesis™ Mouse Anti-slc35a1 Antibody (CBMOAB-05939FYB)


Cat: CBMOAB-05939FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05939FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Hamsters (Cricetinae), Rhesus (Macaca mulatta) WB, ELISA MO05939FYB 100 µg
MO-AB-06056W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06056W 100 µg
MO-AB-07741H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07741C 100 µg
MO-AB-10918W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10918W 100 µg
MO-AB-20375R Monoclonal Cattle (Bos taurus) WB, ELISA MO20375R 100 µg
MO-AB-33373W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33373W 100 µg
MO-AB-43438W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43438W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Hamsters (Cricetinae), Rhesus (Macaca mulatta)
CloneMO05939FYB
SpecificityThis antibody binds to Zebrafish slc35a1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish slc35a1 Antibody is a mouse antibody against slc35a1. It can be used for slc35a1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWu:fl06g06; slc35a1; wu:fl06g0
UniProt IDB3DIQ6
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: MASESVSVLFKLYCLTVMTLIAATYTVALRYTRTVSTELYFSTTAVCLAEIIKLLLSLIMLVRETGDVGRCRAALVTHIFRSPKELLKLSVPSVVYAIQNNMAFVALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSRLQWFSVFMLCAGVTLVQWTPPHSTKVQVEQNPFLGFMAIAVAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLMGVYMTDGARVLEKGFFYGYTPWVCLVVFLASVGGMYTSVVVKYTDNIMKGFSAAAAIVLSTVASVLLFGLQITLTFISGALLVCVSIYLYGLPKQDTTKVMKAGAEQDDTHKLISV.
For Research Use Only | Not For Clinical Use.
Online Inquiry