AibGenesis™ Mouse Anti-slc35b1 Antibody (CBMOAB-05949FYB)


Cat: CBMOAB-05949FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05949FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO05949FYB 100 µg
CBMOAB-58172FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58172FYA 100 µg
MO-AB-06057W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06057W 100 µg
MO-AB-13849W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13849W 100 µg
MO-AB-20385R Monoclonal Cattle (Bos taurus) WB, ELISA MO20385R 100 µg
MO-AB-64626W Monoclonal Marmoset WB, ELISA MO64626W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO05949FYB
SpecificityThis antibody binds to Zebrafish slc35b1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nucleotide sugar transporter which is a member of solute carrier family 35. The transporters in this family are highly conserved hydrophobic proteins with multiple transmembrane domains. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Zebrafish slc35b1 Antibody is a mouse antibody against slc35b1. It can be used for slc35b1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSolute carrier family 35 member B1; slc35b
UniProt IDQ66HX0
Protein RefseqThe length of the protein is 329 amino acids long.
The sequence is show below: MAAGKAASKPSLWQNERVRFAVCFCGVFVCYFYYGILQETITRADYTHAGKKEKFRYATTLVFIQCIINAAFARLLIQFFEGSKQDHTRSWLYGLCSLSYLGAMVSSNSALQYVNYPTQVLGKSCKPIPVMILGVTILRKKYPMAKYLCVFLIVGGVALFLYKPNKGSSTSDEHVFGFGEMLLLLSLTLDGLTGVVQDHMRGRFQTGANHMMLNVNMWSTLVLGIAVLWSGEVWEFLAFTDRYPSIIYNILLFGITSALGQTFIFMTVVYFGPLTCSIVTTTRKFFTILGSVLLFGNVISHMQWFGTILVFLGLGLDAKFGKSPKKTTH.
For Research Use Only | Not For Clinical Use.
Online Inquiry