AibGenesis™ Mouse Anti-slc39a1 Antibody (CBMOAB-06033FYB)


Cat: CBMOAB-06033FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06033FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Marmoset, Sheep (Ovis aries) WB, ELISA MO06033FYB 100 µg
MO-AB-17668Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17668Y 100 µg
MO-AB-18149W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18149W 100 µg
MO-AB-20416R Monoclonal Cattle (Bos taurus) WB, ELISA MO20416R 100 µg
MO-AB-35684W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35684W 100 µg
MO-AB-38188W Monoclonal Goat (Capra hircus) WB, ELISA MO38188W 100 µg
MO-AB-64666W Monoclonal Marmoset WB, ELISA MO64666W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Marmoset, Sheep (Ovis aries)
CloneMO06033FYB
SpecificityThis antibody binds to Zebrafish slc39a1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the zinc-iron permease family. The encoded protein is localized to the cell membrane and acts as a zinc uptake transporter. This gene has been linked to prostate cancer, breast cancer, and Alzheimer's disease. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish slc39a1 Antibody is a mouse antibody against slc39a1. It can be used for slc39a1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc transporter ZIP1; DrZIP1; Solute carrier family 39 member 1; Zrt- and Irt-like protein 1; ZIP-1; slc39a1; zip
UniProt IDP59889
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MDYLLQVKVGALVGLLLLTLFFGFIPARMKWFHVTGGTELHKAVLSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILEKMVLSCTEGHRNEETAPLLAPAAPNGHAHGHPSVNDLEGSGHHVHVDFHAHSSFRSFMLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVVIETERQAGGLIQAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMAALCFLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry