AibGenesis™ Mouse Anti-SLC66A2 Antibody (MO-AB-15570W)


Cat: MO-AB-15570W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15570W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus) WB, ELISA MO15570W 100 µg
MO-AB-20465R Monoclonal Cattle (Bos taurus) WB, ELISA MO20465R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus)
CloneMO15570W
SpecificityThis antibody binds to Chimpanzee SLC66A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endosome; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee SLC66A2 Antibody is a mouse antibody against SLC66A2. It can be used for SLC66A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPQ loop repeat containing 1; PQLC1
UniProt IDH2QER2
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVANILRILFWFGRRFESPLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFAAADSKDEEVKVAPRRSFLDFDPHHFWQWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPAGTKAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry