AibGenesis™ Mouse Anti-SLC7A14 Antibody (MO-AB-20499R)


Cat: MO-AB-20499R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20499R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO20499R 100 µg
MO-AB-23713W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23713W 100 µg
MO-AB-64772W Monoclonal Marmoset WB, ELISA MO64772W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO20499R
SpecificityThis antibody binds to Cattle SLC7A14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Plasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionImports 4-aminobutanoate (GABA) into lysosomes. May act as a GABA sensor that regulates mTORC2-dependent INS signaling and gluconeogenesis. The transport mechanism and substrate selectivity remain to be elucidated. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against SLC7A14. It can be used for SLC7A14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable cationic amino acid transporter; Solute carrier family 7 member 14; SLC7A14
UniProt IDA0JNI9
Protein RefseqThe length of the protein is 771 amino acids long.
The sequence is show below: MSGFLTSLDPRRVQWGAAWYAMHSRILRTKPVESMLEGTGATTAHGTKLAQVLTTMDLISLGVGSCVGTGMYVVSGLVAKEMAGPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMVDSVGTLNGLGKGEQSYPDLLALVIAIIVTIIVALGVKNSVGFNNVLNVLNLAVWVFIMIAGFFFINGKYWAEGQFLPYGWSGVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry