AibGenesis™ Mouse Anti-slmo1 Antibody (CBMOAB-06359FYB)


Cat: CBMOAB-06359FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06359FYB Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO06359FYB 100 µg
MO-AB-06126W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06126W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO06359FYB
SpecificityThis antibody binds to Zebrafish slmo1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish slmo1 Antibody is a mouse antibody against slmo1. It can be used for slmo1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesslmo1
UniProt IDE7EZZ3
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MKIWSTEHIFSYPWETVIKAAMRKYPNPMNPSVVGVDVLDRNLDTHGRLHSHRLLSTEWGLPGVVKAILGTSRTVTYVKEHSIVDPEEKKMELCSTNITLTNLISVDERLVYRPHPDNPEVTVLTQEAIITVKGVSLSSYLEGLMALTMSANARKGWDAIEWIIQNSEREKCPFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry