AibGenesis™ Mouse Anti-Slx1b Antibody (MO-AB-29012H)


Cat: MO-AB-29012H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-29012H Monoclonal Rat (Rattus norvegicus), Marmoset WB, ELISA MO29012C 100 µg
Inquiry
MO-AB-64843W Monoclonal Marmoset WB, ELISA MO64843W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Marmoset
CloneMO29012C
SpecificityThis antibody binds to Rat Slx1b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene. (From NCBI)
Product OverviewThis product is a mouse antibody against Slx1b. It can be used for Slx1b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRGT00058; Slx1b; Giyd2
UniProt IDQ6TXE1
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MVLILHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEASFTFHLRVLAHMLRVPPWVRLPLTVRWLRPDFRHELCPAPPPHMPIAFGPPPPQPLVPKRPAASEADSERRLDLGAKASCTLCARMLQAWGEGAPRASPGLLNPHSGISTNCTFGSCKKSLLWGNLVGQCHEDTEEEEVDLELEEALLGTGKHLHCGPSECFNAHYIEPMTYCDLIFLVNADNCRHYLNKTLEVKEEVFHLPLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry