AibGenesis™ Mouse Anti-smim1 Antibody (CBMOAB-06517FYB)
Cat: CBMOAB-06517FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06517FYB | Monoclonal | Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO06517FYB | 100 µg | ||
| MO-AB-29020H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29020C | 100 µg | ||
| MO-AB-64917W | Monoclonal | Marmoset | WB, ELISA | MO64917W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO06517FYB |
| Specificity | This antibody binds to Zebrafish smim1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a small, conserved protein that participates in red blood cell formation. The encoded protein is localized to the cell membrane and is the antigen for the Vel blood group. Alternative splicing results in different transcript variants that encode the same protein. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish smim1 Antibody is a mouse antibody against smim1. It can be used for smim1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Small integral membrane protein 1; smim |
| UniProt ID | B3DHH5 |
| Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: MESNGASVQYNRWSEDNITLQEPQSRSRLLGIYNRVFTGRLVIMFKIAASLTVMVVMYIAGYITGFYVHQCG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry