AibGenesis™ Mouse Anti-smim13 Antibody (CBMOAB-06519FYB)


Cat: CBMOAB-06519FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06519FYB Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO06519FYB 100 µg
MO-AB-29024H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29024C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO06519FYB
SpecificityThis antibody binds to Zebrafish smim13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSMIM13 (Small Integral Membrane Protein 13) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish smim13 Antibody is a mouse antibody against smim13. It can be used for smim13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall integral membrane protein 13; smim1
UniProt IDB8JJV5
Protein RefseqThe length of the protein is 88 amino acids long.
The sequence is show below: MWQSVGLTVLVIVATLICVLLFMLFGWYVVWQLFLSKFKFLRELVGDTGSPQAETEPSESESERSSPPTPRQRPKTARQRVIPPDSTT.
For Research Use Only | Not For Clinical Use.
Online Inquiry