AibGenesis™ Mouse Anti-smim14 Antibody (CBMOAB-06521FYB)


Cat: CBMOAB-06521FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06521FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO06521FYB 100 µg
CBMOAB-58544FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58544FYA 100 µg
MO-AB-07849H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07849C 100 µg
MO-AB-20601R Monoclonal Cattle (Bos taurus) WB, ELISA MO20601R 100 µg
MO-AB-29025H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29025C 100 µg
MO-AB-64920W Monoclonal Marmoset WB, ELISA MO64920W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO06521FYB
SpecificityThis antibody binds to Zebrafish smim14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish smim14 Antibody is a mouse antibody against smim14. It can be used for smim14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessmim14; Small Integral Membrane Protein 14
UniProt IDF1QNR0
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: XHLHWVLSVQPESLKDRYKHIRAAYLKRMLLNLFEREERMAEGGFDPCECICSHEHAMRRLINLLRQSQSYCTDTECLQDMPGPNSSVEGDITIPMIIMGWLVLALVLFLFRPASMRGPSANNKPIGPHGNRGREPPAPPVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry