AibGenesis™ Mouse Anti-smim15 Antibody (CBMOAB-06523FYB)
Cat: CBMOAB-06523FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06523FYB | Monoclonal | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rat (Rattus norvegicus) | WB, ELISA | MO06523FYB | 100 µg | ||
| MO-AB-17094W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17094W | 100 µg | ||
| MO-AB-29026H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29026C | 100 µg | ||
| MO-AB-46617W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46617W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rat (Rattus norvegicus) |
| Clone | MO06523FYB |
| Specificity | This antibody binds to Zebrafish smim15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | SMIM15 (Small Integral Membrane Protein 15) is a Protein Coding gene. |
| Product Overview | Mouse Anti-Zebrafish smim15 Antibody is a mouse antibody against smim15. It can be used for smim15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Small integral membrane protein 15; smim1 |
| UniProt ID | A3KNM5 |
| Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: MIDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFIASALLSWKLAKMIEAKDREQKKKQKRQENIAKAKRAKKD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry