AibGenesis™ Mouse Anti-SMIM4 Antibody (CBMOAB-58546FYA)


Cat: CBMOAB-58546FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58546FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO58546FYA 100 µg
MO-AB-17345W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17345W 100 µg
MO-AB-64924W Monoclonal Marmoset WB, ELISA MO64924W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO58546FYA
SpecificityThis antibody binds to Rhesus SMIM4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSMIM4 (Small Integral Membrane Protein 4) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SMIM4 Antibody is a mouse antibody against SMIM4. It can be used for SMIM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSMIM4
UniProt IDF7HNE3
Protein RefseqThe length of the protein is 108 amino acids long.
The sequence is show below: RSLVFQAAVHGEYGRGLGCVRAFQCVVPPYPSPRPRSSMFTRAQVRRILQRVPGKQRLGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry